Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Uncharacterized protein C8orf90 (CHO90)

This Recombinant Human Uncharacterized protein C8orf90 (CHO90) spans the amino acid sequence from region 1-192. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Uncharacterized protein C8orf90 C8orf90

UniProt

A0A2R8Y2Y2

Expression Region

1-192

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

MASSCPGTPSPAGLPPPSVATPGETLGPAAPPEPAFPDIYGGDAQLWEAHFRGIGRAYRALGKQDDFAIRVLTENFTLPFPFAWPPGSDPACGPLFYDPRDRADFDFLLRGPGASPPALLRPLHATAQAAMRKRRLERLALSCARARGPGPASSCCCPAPPPPSRSPRPALPATAPPGWPRPRRCPESEQNK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human FIZ1 activation kit by CRISPRa
GA113769 1 Kit

Human FIZ1 activation kit by CRISPRa

Sign In for Pricing
View Details
B4GALT4 (NM_003778) Human Recombinant Protein
TP720426L 500 µg

B4GALT4 (NM_003778) Human Recombinant Protein

Sign In for Pricing
View Details
AEBP2 (NM_153207) Human Over-expression Lysate
LC403504 20 µg

AEBP2 (NM_153207) Human Over-expression Lysate

Sign In for Pricing
View Details
alpha Adducin (ADD1) Rabbit Polyclonal Antibody
AP06003PU-N 100 µg

alpha Adducin (ADD1) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Gamma tubuLin complex component 3 (TUBGCP3) (NM_001286278) Human Tagged ORF Clone
RG239637 10 µg

Gamma tubuLin complex component 3 (TUBGCP3) (NM_001286278) Human Tagged ORF Clone

Sign In for Pricing
View Details
ZNF706 (NM_001042511) Human Over-expression Lysate
LC420951 20 µg

ZNF706 (NM_001042511) Human Over-expression Lysate

Sign In for Pricing
View Details