Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Small integral membrane protein 41 (SIM41), partial

This Recombinant Human Small integral membrane protein 41 (SIM41), partial spans the amino acid sequence from region 1-37. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Small integral membrane protein 41 SMIM41

UniProt

A0A2R8YCJ5

Expression Region

1-37

Origin

Homo sapiens (Human)

Field of Research

Cell Biology

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

MNGSQAGAAAQAAWLSSCCNQSASPPEPPEGPRAVQA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

JNK3 (MAPK10) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI2H6]
TA813291AM 100 µL

JNK3 (MAPK10) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI2H6]

Sign In for Pricing
View Details
Human ZNF891 activation kit by CRISPRa
GA119445 1 Kit

Human ZNF891 activation kit by CRISPRa

Sign In for Pricing
View Details
Di(p-anisyl)iodonium Bromide
TRC-D417060-5G 5 g

Di(p-anisyl)iodonium Bromide

Sign In for Pricing
View Details
TOLLIP Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI1D1]
TA506966AM 100 µL

TOLLIP Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI1D1]

Sign In for Pricing
View Details
1-Benzylindole-5-boronic Acid Pinacol Ester
TRC-B279973-250MG 250 mg

1-Benzylindole-5-boronic Acid Pinacol Ester

Sign In for Pricing
View Details
FAU (NM_001997) Human Recombinant Protein
TP307711M 100 µg

FAU (NM_001997) Human Recombinant Protein

Sign In for Pricing
View Details