Recombinant Human Small integral membrane protein 41 (SIM41), partial
This Recombinant Human Small integral membrane protein 41 (SIM41), partial spans the amino acid sequence from region 1-37. Purity: Greater than 85% as determined by SDS-PAGE.
Product Specifications
Product Name Alternative
Small integral membrane protein 41 SMIM41
UniProt
A0A2R8YCJ5
Expression Region
1-37
Origin
Homo sapiens (Human)
Field of Research
Cell Biology
Endotoxin
Not test
Purity
Greater than 85% as determined by SDS-PAGE.
Form
Liquid or Lyophilized powder
Storage Conditions
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week
Notes
For research use only.
Preservative
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
AA Sequence
MNGSQAGAAAQAAWLSSCCNQSASPPEPPEGPRAVQA
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
HP300687 200 Reactions
MIR1244-2 Human qPCR Primer Pair (MI0015974)
Sign In for Pricing
View Details 
