Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Secretory calcium-binding phosphoprotein proline-glutamine rich 1 (SCPPQ)

This Recombinant Human Secretory calcium-binding phosphoprotein proline-glutamine rich 1 (SCPPQ) spans the amino acid sequence from region 16-79. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Secretory calcium-binding phosphoprotein proline-glutamine rich 1 SCPPPQ1

UniProt

A0A411D538

Expression Region

16-79

Origin

Homo sapiens (Human)

Field of Research

Pharmacology & Drug Discovery

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

LPIPLEQYAESSSEQRFIFYPPQVPPFFPQVLFPLPPQPPLVLTPNDLIALLIAILNQLGILFP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SHP2 Antibody
E45R32565G-4 50 µL

SHP2 Antibody

Sign In for Pricing
View Details
Recombinant Human Centrin-1 Protein, GST, E.coli-10ug
QP7526-ec-10ug 10ug

Recombinant Human Centrin-1 Protein, GST, E.coli-10ug

Sign In for Pricing
View Details
Rabbit Interleukin 8 (IL8) ELISA Kit
orb1665370-01 48 Tests

Rabbit Interleukin 8 (IL8) ELISA Kit

Sign In for Pricing
View Details
Rabbit Interleukin 8 (IL8) ELISA Kit
orb1665370-02 96 Tests

Rabbit Interleukin 8 (IL8) ELISA Kit

Sign In for Pricing
View Details
Lentiviral mouse Rdh7 shRNA (UAS) - Lentiviral mouse Rdh7 shRNA (UAS) (100)
GTR15196134 1 Vial

Lentiviral mouse Rdh7 shRNA (UAS) - Lentiviral mouse Rdh7 shRNA (UAS) (100)

Sign In for Pricing
View Details
Lentiviral human FGD6 sgRNA gene knockout kit - Lentiviral human FGD6 sgRNA gene knockout kit (100)
GTR15396157 1 Vial

Lentiviral human FGD6 sgRNA gene knockout kit - Lentiviral human FGD6 sgRNA gene knockout kit (100)

Sign In for Pricing
View Details