Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human T-cell receptor gamma alternate reading frame protein (TARP)

This Recombinant Human T-cell receptor gamma alternate reading frame protein (TARP) spans the amino acid sequence from region 1-58. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

T-cell receptor gamma alternate reading frame protein; TARP; TRGC1

UniProt

A2JGV3

Expression Region

1-58

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

MQMFPPSPLFFFLQLLKQSSRRLEHTFVFLRNFSLMLLRYIGKKRRATRFWDPRRGTP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human CD8B Protein, C-Fc
orb2833294-01 20 µg

Recombinant Human CD8B Protein, C-Fc

Sign In for Pricing
View Details
Recombinant Human CD8B Protein, C-Fc
orb2833294-02 50 µg

Recombinant Human CD8B Protein, C-Fc

Sign In for Pricing
View Details
Recombinant Human CD8B Protein, C-Fc
orb2833294-03 100 µg

Recombinant Human CD8B Protein, C-Fc

Sign In for Pricing
View Details
Lyophilized exosomes from MDA-MB-435S cell line cell culture media
EXA-0822-CY105 5 Vials (> 1x 10^10 PaRoom Temperatureicles/Vial)

Lyophilized exosomes from MDA-MB-435S cell line cell culture media

Sign In for Pricing
View Details
HUWE1 discontinued
537636-01 30ul

HUWE1 discontinued

Sign In for Pricing
View Details
HUWE1 discontinued
537636-02 100 µL

HUWE1 discontinued

Sign In for Pricing
View Details