Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human LMO7 downstream neighbor protein (LMO7D)

This Recombinant Human LMO7 downstream neighbor protein (LMO7D) spans the amino acid sequence from region 1-122. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

LMO7 downstream neighbor protein LMO7DN C13orf45

UniProt

F2Z398

Expression Region

1-122

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

MTWLDKGVWTQEDENSCSFSESDFPGCRDQINPSIPSIWTAVSGMMISLEVRWWIKGKQGYVISLGHALSPRLECSGTFSAHCILGLPGGSSYPPASVSQVVGTTALYLVEEAWAEAGKMRS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

L-Aspartic-13C4 Acid
TRC-A790213-1MG 1 mg

L-Aspartic-13C4 Acid

Sign In for Pricing
View Details
NIPSNAP1 Human Gene Knockout Kit (CRISPR)
KN401270 1 Kit

NIPSNAP1 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
C1QA / Complement C1q A-Chain (C1QA/2955), 1mg/mL
BNUM2955-50 1x 50 µL

C1QA / Complement C1q A-Chain (C1QA/2955), 1mg/mL

Sign In for Pricing
View Details
Rcn2 Mouse Gene Knockout Kit (CRISPR)
KN514615 1 Kit

Rcn2 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
PKC alpha (PRKCA) (C-term) Rabbit Polyclonal Antibody
AP23369PU-N 100 µg

PKC alpha (PRKCA) (C-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
STAT2 Antibody
KC-3488-01 50 μL

STAT2 Antibody

Sign In for Pricing
View Details