Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Small integral membrane protein 10-like protein 1 (SIML1)

This Recombinant Human Small integral membrane protein 10-like protein 1 (SIML1) spans the amino acid sequence from region 1-68. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Small integral membrane protein 10-like protein 1 SMIM10L1

UniProt

P0DMW3

Expression Region

1-68

Origin

Homo sapiens (Human)

Field of Research

Cell Biology

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

MAPAAAPSSLAVRASSPAATPTSYGVFCKGLSRTLLAFFELAWQLRMNFPYFYVAGSVILNIRLQVHI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tyrosinase (T311), CF640R conjugate, 0.1mg/mL
BNC400012-500 1x 500 µL

Tyrosinase (T311), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cytokeratin 8/18 (C-51), CF568 conjugate, 0.1mg/mL
BNC680034-100 1x 100 µL

Cytokeratin 8/18 (C-51), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD8 (RIV11), CF647 conjugate, 0.1mg/mL
BNC470333-100 1x 100 µL

CD8 (RIV11), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
P53 (PAb122), CF647 conjugate, 0.1mg/mL
BNC470338-100 1x 100 µL

P53 (PAb122), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
TGF-beta (1D11.16.8), CF568 conjugate, 0.1mg/mL
BNC680977-500 1x 500 µL

TGF-beta (1D11.16.8), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD47 (B6H12.2), CF594 conjugate, 0.1mg/mL
BNC940437-500 1x 500 µL

CD47 (B6H12.2), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details