Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Small integral membrane protein 10-like protein 2A (SIL2A)

This Recombinant Human Small integral membrane protein 10-like protein 2A (SIL2A) spans the amino acid sequence from region 1-78. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Small integral membrane protein 10-like protein 2A SMIM10L2A LINC00086 NCRNA00086

UniProt

P0DMW4

Expression Region

1-78

Origin

Homo sapiens (Human)

Field of Research

Cell Biology

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

MAASAALSAAAAAAALSGLAVRLSRSAAARGSYGAFCKGLTRTLLTFFDLAWRLRMNFPYFYIVASVMLNVRLQVRIE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human REXO5 activation kit by CRISPRa
GA113110 1 Kit

Human REXO5 activation kit by CRISPRa

Sign In for Pricing
View Details
ApoE Polyclonal Antibody
D-AB-10392L-01 25 µL

ApoE Polyclonal Antibody

Sign In for Pricing
View Details
ApoE Polyclonal Antibody
D-AB-10392L-02 100 µL

ApoE Polyclonal Antibody

Sign In for Pricing
View Details
Tissue FFPE Sections, Colon: sigmoid
CS703802 5x 5 µm

Tissue FFPE Sections, Colon: sigmoid

Sign In for Pricing
View Details
Human SIA8C (ST8SIA3) activation kit by CRISPRa
GA109519 1 Kit

Human SIA8C (ST8SIA3) activation kit by CRISPRa

Sign In for Pricing
View Details
YY1 Antibody
KC-28794-01 50 μL

YY1 Antibody

Sign In for Pricing
View Details