Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Small integral membrane protein 10-like protein 2B (SIL2B)

This Recombinant Human Small integral membrane protein 10-like protein 2B (SIL2B) spans the amino acid sequence from region 1-78. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Small integral membrane protein 10-like protein 2B SMIM10L2B LINC00087 NCRNA00087

UniProt

P0DMW5

Expression Region

1-78

Origin

Homo sapiens (Human)

Field of Research

Cell Biology

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

MAASAALSAAAAAAALSGLAVRLSRSAAARGSYGAFCKGLTRTLLTFFDLAWRLRMNFPYFYIVASVMLNVRLQVRIE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Taurocholic Acid Sodium Salt Hydrate
TRC-T008851-250MG 250 mg

Taurocholic Acid Sodium Salt Hydrate

Sign In for Pricing
View Details
OR6T1 (C-term) Rabbit Polyclonal Antibody
AP53099PU-N 400 µL

OR6T1 (C-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Frozen Tissue Sections, Aortic valve
CS509904 5x 5 µm

Frozen Tissue Sections, Aortic valve

Sign In for Pricing
View Details
Human Quiescin Q6 Sulfhydryl Oxidase 1 (QSOX1) ELISA Kit
RD-QSOX1-Hu-01 96 Tests

Human Quiescin Q6 Sulfhydryl Oxidase 1 (QSOX1) ELISA Kit

Sign In for Pricing
View Details
Human Quiescin Q6 Sulfhydryl Oxidase 1 (QSOX1) ELISA Kit
RD-QSOX1-Hu-02 48 Tests

Human Quiescin Q6 Sulfhydryl Oxidase 1 (QSOX1) ELISA Kit

Sign In for Pricing
View Details
Chromium(III) Chloride Hexahydrate
TRC-C432620-250G 250 g

Chromium(III) Chloride Hexahydrate

Sign In for Pricing
View Details