Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Small integral membrane protein 10-like protein 2B (SIL2B)

This Recombinant Human Small integral membrane protein 10-like protein 2B (SIL2B) spans the amino acid sequence from region 1-78. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Small integral membrane protein 10-like protein 2B SMIM10L2B LINC00087 NCRNA00087

UniProt

P0DMW5

Expression Region

1-78

Origin

Homo sapiens (Human)

Field of Research

Cell Biology

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

MAASAALSAAAAAAALSGLAVRLSRSAAARGSYGAFCKGLTRTLLTFFDLAWRLRMNFPYFYIVASVMLNVRLQVRIE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

LB30870
HY-125368 1 Each

LB30870

Sign In for Pricing
View Details
Mouse TGFbI (Transforming Growth Factor Beta Induced Protein) Microsample ELISA Kit
orb2999335-01 48 Tests

Mouse TGFbI (Transforming Growth Factor Beta Induced Protein) Microsample ELISA Kit

Sign In for Pricing
View Details
Mouse TGFbI (Transforming Growth Factor Beta Induced Protein) Microsample ELISA Kit
orb2999335-02 96 Tests

Mouse TGFbI (Transforming Growth Factor Beta Induced Protein) Microsample ELISA Kit

Sign In for Pricing
View Details
Rabbit Polyclonal CYB5R2 Antibody [Alexa Fluor 488]
NBP2-97413AF488 0.1 mL

Rabbit Polyclonal CYB5R2 Antibody [Alexa Fluor 488]

Sign In for Pricing
View Details
Human X-Ray Repair Cross Complementing 6 (XRCC6) ELISA Kit
EKN49356 96 Tests

Human X-Ray Repair Cross Complementing 6 (XRCC6) ELISA Kit

Sign In for Pricing
View Details
Mouse Monoclonal Cyclophilin B Antibody (CL3915)
NBP2-59782-25ul 25 µL

Mouse Monoclonal Cyclophilin B Antibody (CL3915)

Sign In for Pricing
View Details