Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Late cornified envelope protein 7A (LCE7A)

This Recombinant Human Late cornified envelope protein 7A (LCE7A) spans the amino acid sequence from region 1-95. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Late cornified envelope protein 7A LCE7A

UniProt

P0DV60

Expression Region

1-95

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

MSYQKHQQKWQLPAKCLPKYPSKWTPQAPASCPAPCPPPAPSCCVSSCCISGFGGHCSLVSLRFPRFYLRQPQHSDCCEHESSRCSTCYSSGDCS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human CD85e/LILRA3 Recombinant Protein
PPT-11682 100 µg

Human CD85e/LILRA3 Recombinant Protein

Sign In for Pricing
View Details
Insulin receptor substrate 1 IRS1 Rabbit Polyclonal Antibody (HRP)
orb2574434 100 µg

Insulin receptor substrate 1 IRS1 Rabbit Polyclonal Antibody (HRP)

Sign In for Pricing
View Details
ALKBH3 Blocking Peptide
33R-2593 100 ug

ALKBH3 Blocking Peptide

Sign In for Pricing
View Details
Lentiviral mouse Sugp1 shRNA (UAS) - Lentiviral mouse Sugp1 shRNA (UAS) (100)
GTR15270438 1 Vial

Lentiviral mouse Sugp1 shRNA (UAS) - Lentiviral mouse Sugp1 shRNA (UAS) (100)

Sign In for Pricing
View Details
TP53AIP1 ORF Vector (Human) (pORF)
47327011 1.0 µg DNA

TP53AIP1 ORF Vector (Human) (pORF)

Sign In for Pricing
View Details
PEX12 (NM_000286) Human Over-expression Lysate
E45H02845-2 20 µg

PEX12 (NM_000286) Human Over-expression Lysate

Sign In for Pricing
View Details