Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Embryonic testis differentiation protein homolog A (ETDA)

This Recombinant Human Embryonic testis differentiation protein homolog A (ETDA) spans the amino acid sequence from region 1-59. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Embryonic testis differentiation protein homolog A ETDA

UniProt

Q3ZM63

Expression Region

1-59

Origin

Homo sapiens (Human)

Field of Research

Stem Cell & Developmental Biology

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

MDKEVPKGSPREPALNIKKSDKSFKRKKPTENVLIFLINRQLGRHRSDIDLSRWVWMLS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CA IV CRISPR Activation Plasmid (h2)
sc-404215-ACT-2 20 µg

CA IV CRISPR Activation Plasmid (h2)

Sign In for Pricing
View Details
H-D-Glu-OtBu
5-02747 1 g

H-D-Glu-OtBu

Sign In for Pricing
View Details
Psmb1 Antibody
RQ6511 100 µg

Psmb1 Antibody

Sign In for Pricing
View Details
LARP4 Polyclonal Conjugated Antibody
orb1626471 100 µL

LARP4 Polyclonal Conjugated Antibody

Sign In for Pricing
View Details
VSIG1 Antibody
CSB-PA025926GA01HU 100 µL

VSIG1 Antibody

Sign In for Pricing
View Details
Rat HSP90AB1 Matched Antibody Pair Set [ABP-S-04473]
ABP-S-04473 5 Plates

Rat HSP90AB1 Matched Antibody Pair Set [ABP-S-04473]

Sign In for Pricing
View Details