Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Titin (Ttn), partial

This Recombinant Mouse Titin (Ttn), partial spans the amino acid sequence from region 9719-9809aa. Purity: Greater than 95% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Connectin

UniProt

A2ASS6

Expression Region

9719-9809aa

Tag

C-terminal 6xHis-tagged

Source

E.coli

Origin

Mus musculus (Mouse)

Field of Research

Signal Transduction

Endotoxin

Not test

Purity

Greater than 95% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

17.3 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

AEPIQFTKRIQNIVVSEHQSATFECEVSFDDAIVTWYKGPTELTESQKYNFRNDGRCHYMTIHNVTPDDEGVYSVIARLEPRGEARSTAEL

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Sort1 Antibody, HRP conjugated
A35416-50UG 50 µg

Sort1 Antibody, HRP conjugated

Sign In for Pricing
View Details
ANKRD33 CRISPRa sgRNA lentivector (set of three targets)(Mouse)
11985124 3x 1.0µg DNA

ANKRD33 CRISPRa sgRNA lentivector (set of three targets)(Mouse)

Sign In for Pricing
View Details
Neu4 Lentiviral Activation Particles (h2)
sc-406284-LAC-2 200 µL

Neu4 Lentiviral Activation Particles (h2)

Sign In for Pricing
View Details
Constitutive androstane receptor (NR1I3) (NM_001077475) Human Over-expression Lysate
E45H04888-2 20 µg

Constitutive androstane receptor (NR1I3) (NM_001077475) Human Over-expression Lysate

Sign In for Pricing
View Details
MGEA5 Polyclonal Antibody, Biotin Conjugated
bs-6829R-Biotin 100 µL

MGEA5 Polyclonal Antibody, Biotin Conjugated

Sign In for Pricing
View Details
Rabbit anti-Rictor IHC Antibody, Affinity Purified
MBS3907736-01 0.0025 mg

Rabbit anti-Rictor IHC Antibody, Affinity Purified

Sign In for Pricing
View Details