Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Titin (Ttn), partial

This Recombinant Mouse Titin (Ttn), partial spans the amino acid sequence from region 9719-9809aa. Purity: Greater than 95% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Connectin

UniProt

A2ASS6

Expression Region

9719-9809aa

Tag

C-terminal 6xHis-tagged

Source

E.coli

Origin

Mus musculus (Mouse)

Field of Research

Signal Transduction

Endotoxin

Not test

Purity

Greater than 95% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

17.3 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

AEPIQFTKRIQNIVVSEHQSATFECEVSFDDAIVTWYKGPTELTESQKYNFRNDGRCHYMTIHNVTPDDEGVYSVIARLEPRGEARSTAEL

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-TIG2 Antibody
CPA1991-01 30 µL

Anti-TIG2 Antibody

Sign In for Pricing
View Details
Anti-TIG2 Antibody
CPA1991-02 50 μL

Anti-TIG2 Antibody

Sign In for Pricing
View Details
Anti-TIG2 Antibody
CPA1991-03 100 µL

Anti-TIG2 Antibody

Sign In for Pricing
View Details
Anti-TIG2 Antibody
CPA1991-04 200 µL

Anti-TIG2 Antibody

Sign In for Pricing
View Details
Abcb4 Mouse Gene Knockout Kit (CRISPR)
KN500615 1 Kit

Abcb4 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
TRIM46
MBS8561585-01 0.2 mL

TRIM46

Sign In for Pricing
View Details