Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Protein Mis18-alpha (MIS18A)

This Recombinant Human Protein Mis18-alpha (MIS18A) spans the amino acid sequence from region 1-233aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

FAPP1-associated protein 1

UniProt

Q9NYP9

Expression Region

1-233aa

Tag

C-terminal 6xHis-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

32.8 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MAGVRSLRCSRGCAGGCECGDKGKCSDSSLLGKRLSEDSSRHQLLQKWASMWSSMSEDASVADMERAQLEEEAAAAEERPLVFLCSGCRRPLGDSLSWVASQEDTNCILLRCVSCNVSVDKEQKLSKREKENGCVLETLCCAGCSLNLGYVYRCTPKNLDYKRDLFCLSVEAIESYVLGSSEKQIVSEDKELFNLESRVEIEKSLTQMEDVLKALQMKLWEAESKLSFATCKS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral mouse Prrc2a shRNA (UAS) - Lentiviral mouse Prrc2a shRNA (UAS, GFP) plasmid
GTR15241054 1 Vial

Lentiviral mouse Prrc2a shRNA (UAS) - Lentiviral mouse Prrc2a shRNA (UAS, GFP) plasmid

Sign In for Pricing
View Details
Anti-CTPS1 Antibody Picoband® FITC Conjugated
A06374-2-FITC 100 µg/Vial

Anti-CTPS1 Antibody Picoband® FITC Conjugated

Sign In for Pricing
View Details
Human OR4F5 knockout cell line
ABC-KH10744 1 Vial

Human OR4F5 knockout cell line

Sign In for Pricing
View Details
Recombinant Drosophila melanogaster Histone deacetylase complex subunit SAP30 homolog (Sap30)
MBS1444675-01 0.02 mg (E-Coli)

Recombinant Drosophila melanogaster Histone deacetylase complex subunit SAP30 homolog (Sap30)

Sign In for Pricing
View Details
Recombinant Drosophila melanogaster Histone deacetylase complex subunit SAP30 homolog (Sap30)
MBS1444675-02 0.1 mg (E-Coli)

Recombinant Drosophila melanogaster Histone deacetylase complex subunit SAP30 homolog (Sap30)

Sign In for Pricing
View Details
Recombinant Drosophila melanogaster Histone deacetylase complex subunit SAP30 homolog (Sap30)
MBS1444675-03 0.02 mg (Yeast)

Recombinant Drosophila melanogaster Histone deacetylase complex subunit SAP30 homolog (Sap30)

Sign In for Pricing
View Details