Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Mitochondrial import inner membrane translocase subunit Tim10 (TIMM10)

This Recombinant Human Mitochondrial import inner membrane translocase subunit Tim10 (TIMM10) spans the amino acid sequence from region 1-90aa. Purity: Greater than 95% as determined by SDS-PAGE.

Product Specifications

UniProt

P62072

Expression Region

1-90aa

Tag

C-terminal 6xHis-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Cell Biology

Endotoxin

Not test

Purity

Greater than 95% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

17.2 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MDPLRAQQLAAELEVEMMADMYNRMTSACHRKCVPPHYKEAELSKGESVCLDRCVSKYLDIHERMGKKLTELSMQDEELMKRVQQSSGPA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

2-Arm PEG-NHS (MW 5000)
HY-W1048512C 1 Each

2-Arm PEG-NHS (MW 5000)

Sign In for Pricing
View Details
Magic™ Membrane Protein Human CD69 (CD69 molecule) expressed in insect for Antibody Discovery
MP0161Q Each

Magic™ Membrane Protein Human CD69 (CD69 molecule) expressed in insect for Antibody Discovery

Sign In for Pricing
View Details
Guinea pig P-cadherin (P-cad) ELISA Kit
EIA06183Gu 1 Kit

Guinea pig P-cadherin (P-cad) ELISA Kit

Sign In for Pricing
View Details
Human ITM2B protein
orb392016-01 10 µg

Human ITM2B protein

Sign In for Pricing
View Details
Human ITM2B protein
orb392016-02 50 µg

Human ITM2B protein

Sign In for Pricing
View Details
Human ITM2B protein
orb392016-03 500 µg

Human ITM2B protein

Sign In for Pricing
View Details