Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Heme oxygenase 1 (HMOX1), partial

This Recombinant Human Heme oxygenase 1 (HMOX1), partial spans the amino acid sequence from region 1-237aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

UniProt

P09601

Expression Region

1-237aa

Tag

N-terminal 6xHis-mCherry-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Metabolism Research

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

55.0 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MERPQPDSMPQDLSEALKEATKEVHTQAENAEFMRNFQKGQVTRDGFKLVMASLYHIYVALEEEIERNKESPVFAPVYFPEELHRKAALEQDLAFWYGPRWQEVIPYTPAMQRYVKRLHEVGRTEPELLVAHAYTRYLGDLSGGQVLKKIAQKALDLPSSGEGLAFFTFPNIASATKFKQLYRSRMNSLEMTPAVRQRVIEEAKTAFLLNIQLFEELQELLTHDTKDQSPSRAPGLR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

4- (Ethylthio) benzonitrile
OR1094344 1 Each

4- (Ethylthio) benzonitrile

Sign In for Pricing
View Details
CD16 Antibody [2.4G2]
76-572 0.1 mg

CD16 Antibody [2.4G2]

Sign In for Pricing
View Details
Commd8 Rat siRNA Oligo Duplex (Locus ID 289603)
SR501255 1 Kit

Commd8 Rat siRNA Oligo Duplex (Locus ID 289603)

Sign In for Pricing
View Details
AGA2 Antibody, Biotin conjugated
CSB-PA335766HD01SVG-01 50 µg

AGA2 Antibody, Biotin conjugated

Sign In for Pricing
View Details
AGA2 Antibody, Biotin conjugated
CSB-PA335766HD01SVG-02 100 µg

AGA2 Antibody, Biotin conjugated

Sign In for Pricing
View Details
Anti-ICK Antibody (N451/29)
HV486023-01 50 µg

Anti-ICK Antibody (N451/29)

Sign In for Pricing
View Details