Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse VIP peptides (Vip)

This Recombinant Mouse VIP peptides (Vip) spans the amino acid sequence from region 80-155aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

UniProt

P32648

Expression Region

80-155aa

Tag

C-terminal 6xHis-tagged

Source

E.coli

Origin

Mus musculus (Mouse)

Field of Research

Neuroscience

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

15.6 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

RHADGVFTSDYSRLLGQISAKKYLESLIGKRISSSISEDPVPIKRHSDAVFTDNYTRLRKQMAVKKYLNSILNGKR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mmu-let-7a-5p miRNA Mimic
orb1876060-01 5 nmol

Mmu-let-7a-5p miRNA Mimic

Sign In for Pricing
View Details
Mmu-let-7a-5p miRNA Mimic
orb1876060-02 10 nmol

Mmu-let-7a-5p miRNA Mimic

Sign In for Pricing
View Details
CD8a (CD8 antigen, alpha polypeptide (p32), T8/Leu-2 T-lymphocyte differentiation antigen, Ly3, LYT3, MAL, T-cell surface glycoprotein CD8 alpha chain) (PE)
168727-AF-PE 100 µL

CD8a (CD8 antigen, alpha polypeptide (p32), T8/Leu-2 T-lymphocyte differentiation antigen, Ly3, LYT3, MAL, T-cell surface glycoprotein CD8 alpha chain) (PE)

Sign In for Pricing
View Details
VEGFA Mouse Monoclonal Antibody [Clone ID: OTI2F7]
CF500288 100 µg

VEGFA Mouse Monoclonal Antibody [Clone ID: OTI2F7]

Sign In for Pricing
View Details
Aldh3a2 sgRNA CRISPR Lentivector (Mouse) (Target 3)
K3833604 1.0 µg DNA

Aldh3a2 sgRNA CRISPR Lentivector (Mouse) (Target 3)

Sign In for Pricing
View Details
Rat cecropin ELISA Kit
MBS260547-01 48 Well

Rat cecropin ELISA Kit

Sign In for Pricing
View Details