Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Lymphocyte antigen 6 complex locus protein G6c (LY6G6C)

This Recombinant Human Lymphocyte antigen 6 complex locus protein G6c (LY6G6C) spans the amino acid sequence from region 19-99aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

UniProt

O95867

Expression Region

19-99aa

Tag

C-terminal 6xHis-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

16.1 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

DIRCHSCYKVPVLGCVDRQSCRLEPGQQCLTTHAYLGKMWVFSNLRCGTPEEPCQEAFNQTNRKLGLTYNTTCCNKDNCNS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CHMP4B Antibody Blocking peptide
orb1444101 500 µg

CHMP4B Antibody Blocking peptide

Sign In for Pricing
View Details
PSME3 Antibody
30-167 100 µL

PSME3 Antibody

Sign In for Pricing
View Details
Human FGFR1 knockout cell line
ABC-KH5530 1 Vial

Human FGFR1 knockout cell line

Sign In for Pricing
View Details
Cytochrome P450 3A7 Antibody
E19-4748 100 µg -100 µL

Cytochrome P450 3A7 Antibody

Sign In for Pricing
View Details
Vascular Endothelial Growth Inhibitor (VEGI) (MaxLight 650)
MBS6505725-01 0.1 mL

Vascular Endothelial Growth Inhibitor (VEGI) (MaxLight 650)

Sign In for Pricing
View Details
Vascular Endothelial Growth Inhibitor (VEGI) (MaxLight 650)
MBS6505725-02 5x 0.1 mL

Vascular Endothelial Growth Inhibitor (VEGI) (MaxLight 650)

Sign In for Pricing
View Details