Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Matrix metalloproteinase-14 (MMP14), partial

This Recombinant Human Matrix metalloproteinase-14 (MMP14), partial spans the amino acid sequence from region 21-284aa. Purity: Greater than 95% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

MMP-X1; Membrane-type matrix metalloproteinase 1; Membrane-type-1 matrix metalloproteinase

UniProt

P50281

Expression Region

21-284aa

Tag

C-terminal 10xHis-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Musculoskeletal & Connective Tissue Research

Endotoxin

Not test

Purity

Greater than 95% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

37.1 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

ALASLGSAQSSSFSPEAWLQQYGYLPPGDLRTHTQRSPQSLSAAIAAMQKFYGLQVTGKADADTMKAMRRPRCGVPDKFGAEIKANVRRKRYAIQGLKWQHNEITFCIQNYTPKVGEYATYEAIRKAFRVWESATPLRFREVPYAYIREGHEKQADIMIFFAEGFHGDSTPFDGEGGFLAHAYFPGPNIGGDTHFDSAEPWTVRNEDLNGNDIFLVAVHELGHALGLEHSSDPSAIMAPFYQWMDTENFVLPDDDRRGIQQLYG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

QuicKey Pro Human IL-8 (Interleukin 8) ELISA Kit
E-OSEL-H0014-01 24 Tests

QuicKey Pro Human IL-8 (Interleukin 8) ELISA Kit

Sign In for Pricing
View Details
QuicKey Pro Human IL-8 (Interleukin 8) ELISA Kit
E-OSEL-H0014-02 48 Tests

QuicKey Pro Human IL-8 (Interleukin 8) ELISA Kit

Sign In for Pricing
View Details
QuicKey Pro Human IL-8 (Interleukin 8) ELISA Kit
E-OSEL-H0014-03 96 Tests

QuicKey Pro Human IL-8 (Interleukin 8) ELISA Kit

Sign In for Pricing
View Details
DEK Polyclonal Antibody
E95901 100 µL

DEK Polyclonal Antibody

Sign In for Pricing
View Details
Anti-alpha 1 Antichymotrypsin  (3F5)
YF-MA11788 100 ug

Anti-alpha 1 Antichymotrypsin (3F5)

Sign In for Pricing
View Details
NOS2 ELISA Kit (Pig) (OKEH07088)
OKEH07088 96 Well

NOS2 ELISA Kit (Pig) (OKEH07088)

Sign In for Pricing
View Details