Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Caspase-8 (CASP8), partial

This Recombinant Human Caspase-8 (CASP8), partial spans the amino acid sequence from region 217-374aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Apoptotic cysteine protease; Apoptotic protease Mch-5; CAP4; FADD-homologous ICE/ced-3-like protease; FADD-like ICE; ICE-like apoptotic protease 5; MORT1-associated ced-3 homolog

UniProt

Q14790

Expression Region

217-374aa

Tag

C-terminal 6xHis-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Cell Biology

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

24.8 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

SESQTLDKVYQMKSKPRGYCLIINNHNFAKAREKVPKLHSIRDRNGTHLDAGALTTTFEELHFEIKPHDDCTVEQIYEILKIYQLMDHSNMDCFICCILSHGDKGIIYGTDGQEAPIYELTSQFTGLKCPSLAGKPKVFFIQACQGDNYQKGIPVETD

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

1-Propylpiperidin-4-amine 2HCl
FP113242-01 1 g

1-Propylpiperidin-4-amine 2HCl

Sign In for Pricing
View Details
1-Propylpiperidin-4-amine 2HCl
FP113242-02 2 g

1-Propylpiperidin-4-amine 2HCl

Sign In for Pricing
View Details
1-Propylpiperidin-4-amine 2HCl
FP113242-03 5 g

1-Propylpiperidin-4-amine 2HCl

Sign In for Pricing
View Details
1-Propylpiperidin-4-amine 2HCl
FP113242-04 10 g

1-Propylpiperidin-4-amine 2HCl

Sign In for Pricing
View Details
1-Propylpiperidin-4-amine 2HCl
FP113242-05 25 g

1-Propylpiperidin-4-amine 2HCl

Sign In for Pricing
View Details
2-(2-Boc-aminoethoxy)ethanol
TRC-B618575-5G 5 g

2-(2-Boc-aminoethoxy)ethanol

Sign In for Pricing
View Details