Recombinant Mouse Neudesin (Nenf)
This Recombinant Mouse Neudesin (Nenf) spans the amino acid sequence from region 31-171aa. Purity: Greater than 95% as determined by SDS-PAGE.
Product Specifications
Product Name Alternative
Neuron-derived neurotrophic factor; Secreted protein of unknown function
UniProt
Q9CQ45
Expression Region
31-171aa
Tag
C-terminal 6xHis-tagged
Source
E.coli
Origin
Mus musculus (Mouse)
Field of Research
Cell Biology
Endotoxin
Not test
Purity
Greater than 95% as determined by SDS-PAGE.
Form
Liquid or Lyophilized powder
Molecular Weight
22.5 kDa
Storage Conditions
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes
For research use only.
Applications Notes
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Preservative
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
AA Sequence
GQTPRPAERGPPVRLFTEEELARYGGEEEDQPIYLAVKGVVFDVTSGKEFYGRGAPYNALAGKDSSRGVAKMSLDPADLTHDTTGLTAKELEALDDVFSKVYKAKYPIVGYTARRILNEDGSPNLDFKPEDQPHFDIKDEF
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC740031-100 1x 100 µL
Mucin 5AC (MUC5AC) (45M1), CF740 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC880003-100 1x 100 µL
CD45RO (UCHL-1), CF488A conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC940676-500 1x 500 µL
MUC18 / Mucin 18 / CD146 (OJ79c), CF594 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
