Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Pentadiplandra brazzeana Defensin-like protein

This Recombinant Pentadiplandra brazzeana Defensin-like protein spans the amino acid sequence from region 1-54aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Brazzein

UniProt

P56552

Expression Region

1-54aa

Tag

C-terminal 6xHis-tagged

Source

E.coli

Origin

Pentadiplandra brazzeana

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

13.4 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

QDKCKKVYENYPVSKCQLANQCNYDCKLDKHARSGECFYDEKRNLQCICDYCEY

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Perforin-1 (Pore Forming Protein) (Apoptosis Marker) (PRF1/2467), CF594 conjugate, 0.1mg/mL
BNC942467-500 1x 500 µL

Perforin-1 (Pore Forming Protein) (Apoptosis Marker) (PRF1/2467), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
TKTL2 Lentiviral Activation Particles (h)
sc-413546-LAC 200 µL

TKTL2 Lentiviral Activation Particles (h)

Sign In for Pricing
View Details
Recombinant Mouse RNA-binding protein 12 (Rbm12) , partial
MBS1428624 Inquire

Recombinant Mouse RNA-binding protein 12 (Rbm12) , partial

Sign In for Pricing
View Details
Human GBP2 Recombinant Protein
PPT-12852 100 µg

Human GBP2 Recombinant Protein

Sign In for Pricing
View Details
Rabbit Polyclonal CRIPT Antibody
NBP2-33453-25ul 25 µL

Rabbit Polyclonal CRIPT Antibody

Sign In for Pricing
View Details
B4GALNT2 Protein Vector (Human) (pPM-C-His)
PV049192 500 ng

B4GALNT2 Protein Vector (Human) (pPM-C-His)

Sign In for Pricing
View Details