Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Cat Lutropin subunit beta (LHB)

This Recombinant Cat Lutropin subunit beta (LHB) spans the amino acid sequence from region 23-143aa. Purity: Greater than 95% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Luteinizing hormone subunit beta

UniProt

O77805

Expression Region

23-143aa

Tag

C-terminal 6xHis-tagged

Source

E.coli

Origin

Felis catus (Cat)

Field of Research

Metabolism Research

Endotoxin

Not test

Purity

Greater than 95% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

19.7 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

SREPLRPLCRPINATLAAENEACPVCVTFTTTICAGYCPSMMRVLPAALPPVPQPVCTYRELRFASVRLPGCPPGVDPVVSFPVALSCRCGPCRLSSSDCGGPRAQPLACDRPPLPGLLFL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SAMSN1 Adenovirus (Mouse)
43007054 1.0 mL

SAMSN1 Adenovirus (Mouse)

Sign In for Pricing
View Details
GLP-1R CRISPR Activation Plasmid (h)
sc-400847-ACT 20 µg

GLP-1R CRISPR Activation Plasmid (h)

Sign In for Pricing
View Details
Rabbit Polyclonal SPAG9 Antibody [FITC]
NB100-79794F 0.1 mL

Rabbit Polyclonal SPAG9 Antibody [FITC]

Sign In for Pricing
View Details
Recombinant Human PADI6, GST-tagged
PADI6-1507H 25 µg

Recombinant Human PADI6, GST-tagged

Sign In for Pricing
View Details
Interleukin 8 (IL8) Polyclonal Antibody
CAU28691-01 100 µL

Interleukin 8 (IL8) Polyclonal Antibody

Sign In for Pricing
View Details
Interleukin 8 (IL8) Polyclonal Antibody
CAU28691-02 200 µL

Interleukin 8 (IL8) Polyclonal Antibody

Sign In for Pricing
View Details