Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Islet amyloid polypeptide (IAPP)

This Recombinant Human Islet amyloid polypeptide (IAPP) spans the amino acid sequence from region 1-89aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Amylin; Diabetes-associated peptide; Insulinoma amyloid peptide

UniProt

P10997

Expression Region

1-89aa

Tag

C-terminal 6xHis-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Neuroscience

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

16.7 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MGILKLQVFLIVLSVALNHLKATPIESHQVEKRKCNTATCATQRLANFLVHSSNNFGAILSSTNVGSNTYGKRNAVEVLKREPLNYLPL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

RSPO1 Antibody (Biotin)
KB-7788-01 50 μL

RSPO1 Antibody (Biotin)

Sign In for Pricing
View Details
RSPO1 Antibody (Biotin)
KB-7788-02 100 µL

RSPO1 Antibody (Biotin)

Sign In for Pricing
View Details
RSPO1 Antibody (Biotin)
KB-7788-03 1 mL

RSPO1 Antibody (Biotin)

Sign In for Pricing
View Details
CYGB Protein Vector (Human) (pPM-C-HA)
17300021 500 ng

CYGB Protein Vector (Human) (pPM-C-HA)

Sign In for Pricing
View Details
Anti-Calponin-1 Antibody Clone SPM169, Unconjugated-100ug
1264-MSM1X-P1 100ug

Anti-Calponin-1 Antibody Clone SPM169, Unconjugated-100ug

Sign In for Pricing
View Details
Recombinant Protochlamydia amoebophila UDP-N-acetylenolpyruvoylglucosamine reductase (murB)
MBS1293198-01 0.02 mg (E-Coli)

Recombinant Protochlamydia amoebophila UDP-N-acetylenolpyruvoylglucosamine reductase (murB)

Sign In for Pricing
View Details