Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Cerebellin-4 (Cbln4)

This Recombinant Mouse Cerebellin-4 (Cbln4) spans the amino acid sequence from region 25-198aa. Purity: Greater than 95% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Cerebellin-like glycoprotein 1

UniProt

Q8BME9

Expression Region

25-198aa

Tag

C-terminal 6xHis-tagged

Source

E.coli

Origin

Mus musculus (Mouse)

Field of Research

Neuroscience

Endotoxin

Not test

Purity

Greater than 95% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

26.0 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

QNDTEPIVLEGKCLVVCDSNPATDSKGSSSSPLGISVRAANSKVAFSAVRSTNHEPSEMSNKTRIIYFDQILVNVGNFFTLESVFVAPRKGIYSFSFHVIKVYQSQTIQVNLMLNGKPVISAFAGDKDVTREAATNGVLLYLDKEDKVYLKLEKGNLLGGWQYSTFSGFLVFPL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Phospho-NPM (Thr95) Polyclonal Antibody, Cy7 Conjugated
bs-3309R-Cy7 100 µL

Phospho-NPM (Thr95) Polyclonal Antibody, Cy7 Conjugated

Sign In for Pricing
View Details
8- (6- [Fluoresceinyl]aminohexylthio) - ß- phenyl- 1, N²- ethenoguanosine- 3', 5'- cyclic monophosphate (8-[Fluo]-AHT-PET-cGMP), sodium salt
F 012-05 5x 1 µmol

8- (6- [Fluoresceinyl]aminohexylthio) - ß- phenyl- 1, N²- ethenoguanosine- 3', 5'- cyclic monophosphate (8-[Fluo]-AHT-PET-cGMP), sodium salt

Sign In for Pricing
View Details
GENLISA Human Latrophilin 2 (LPHN2) ELISA
KBH12588 1x 96 Well

GENLISA Human Latrophilin 2 (LPHN2) ELISA

Sign In for Pricing
View Details
Rabbit Polyclonal USH1C Antibody [Alexa Fluor 700]
NBP2-99408AF700 0.1 mL

Rabbit Polyclonal USH1C Antibody [Alexa Fluor 700]

Sign In for Pricing
View Details
PTN Rabbit mAb
F3430-100uL 100 µL

PTN Rabbit mAb

Sign In for Pricing
View Details
Retort Base White 315x200mm Acrylic
STA1038 1 Each

Retort Base White 315x200mm Acrylic

Sign In for Pricing
View Details