Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Cerebellin-4 (Cbln4)

This Recombinant Mouse Cerebellin-4 (Cbln4) spans the amino acid sequence from region 25-198aa. Purity: Greater than 95% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Cerebellin-like glycoprotein 1

UniProt

Q8BME9

Expression Region

25-198aa

Tag

C-terminal 6xHis-tagged

Source

E.coli

Origin

Mus musculus (Mouse)

Field of Research

Neuroscience

Endotoxin

Not test

Purity

Greater than 95% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

26.0 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

QNDTEPIVLEGKCLVVCDSNPATDSKGSSSSPLGISVRAANSKVAFSAVRSTNHEPSEMSNKTRIIYFDQILVNVGNFFTLESVFVAPRKGIYSFSFHVIKVYQSQTIQVNLMLNGKPVISAFAGDKDVTREAATNGVLLYLDKEDKVYLKLEKGNLLGGWQYSTFSGFLVFPL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

RSK1/2/3/4 (Phospho-Ser221/227/S218/232) Antibody
E011753 100 µg -100 µL

RSK1/2/3/4 (Phospho-Ser221/227/S218/232) Antibody

Sign In for Pricing
View Details
CNOT4 Protein Lysate
OCOA16651-20UG 20 µg

CNOT4 Protein Lysate

Sign In for Pricing
View Details
KCNN2 (NM_021614) Human Tagged Lenti ORF Clone
RC213670L2 10 µg

KCNN2 (NM_021614) Human Tagged Lenti ORF Clone

Sign In for Pricing
View Details
CRYM Antibody - middle region : FITC (ARP51982_P050-FITC)
ARP51982_P050-FITC 100 µL

CRYM Antibody - middle region : FITC (ARP51982_P050-FITC)

Sign In for Pricing
View Details
SuperCut  Fast Restriciton Enzymes Eag
8052131 250 Units

SuperCut Fast Restriciton Enzymes Eag

Sign In for Pricing
View Details
RAG1 Protein Lysate (Mouse) with C-HA Tag
38448034 100 µg

RAG1 Protein Lysate (Mouse) with C-HA Tag

Sign In for Pricing
View Details