Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mycobacterium tuberculosis Co-chaperonin GroES (groES)

This Recombinant Mycobacterium tuberculosis Co-chaperonin GroES (groES) spans the amino acid sequence from region 2-100aa. Purity: Greater than 95% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

10 kDa antigen;10 kDa chaperonin; BCG-A heat shock protein; Chaperonin-10

UniProt

P9WPE5

Expression Region

2-100aa

Tag

C-terminal GST-tagged

Source

E.coli

Origin

Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)

Endotoxin

Not test

Purity

Greater than 95% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

42.2 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

AKVNIKPLEDKILVQANEAETTTASGLVIPDTAKEKPQEGTVVAVGPGRWDEDGEKRIPLDVAEGDTVIYSKYGGTEIKYNGEEYLILSARDVLAVVSK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human SOGA3 shRNA Plasmid
abx967726-01 150 µg

Human SOGA3 shRNA Plasmid

Sign In for Pricing
View Details
Human SOGA3 shRNA Plasmid
abx967726-02 300 µg

Human SOGA3 shRNA Plasmid

Sign In for Pricing
View Details
SPT5 Recombinant Antibody, AbBy Fluor™ 350 Conjugated
bsm-62347R-BF350-01 20 µL

SPT5 Recombinant Antibody, AbBy Fluor™ 350 Conjugated

Sign In for Pricing
View Details
SPT5 Recombinant Antibody, AbBy Fluor™ 350 Conjugated
bsm-62347R-BF350-02 100 µL

SPT5 Recombinant Antibody, AbBy Fluor™ 350 Conjugated

Sign In for Pricing
View Details
MECR Rabbit Polyclonal Antibody (Biotin)
orb2095654 100 µL

MECR Rabbit Polyclonal Antibody (Biotin)

Sign In for Pricing
View Details
Dipeptidyl Peptidase 4 / CD26 (DPP4) Antibody
abx102340-01 100 µL

Dipeptidyl Peptidase 4 / CD26 (DPP4) Antibody

Sign In for Pricing
View Details