Recombinant Human Solute carrier organic anion transporter family member 1A2 (SLCO1A2), partial
Selected Variant
GTR19126259-01
Size: 20 µg
This Recombinant Human Solute carrier organic anion transporter family member 1A2 (SLCO1A2), partial spans the amino acid sequence from region 406-513aa. Purity: Greater than 90% as determined by SDS-PAGE.
Product Specifications
Product Name Alternative
OATP-A; Organic anion-transporting polypeptide 1; Sodium-independent organic anion transporter; Solute carrier family 21 member 3
UniProt
P46721
Expression Region
406-513aa
Tag
C-terminal 6xHis-tagged
Source
E.coli
Origin
Homo sapiens (Human)
Endotoxin
Not test
Purity
Greater than 90% as determined by SDS-PAGE.
Form
Liquid or Lyophilized powder
Molecular Weight
18.4 kDa
Storage Conditions
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes
For research use only.
Applications Notes
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Preservative
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
AA Sequence
FLMTCENSSVVGINTSYEGIPQDLYVENDIFADCNVDCNCPSKIWDPVCGNNGLSYLSACLAGCETSIGTGINMVFQNCSCIQTSGNSSAVLGLCDKGPDCSLMLQYF
Available Sizes
Price
Sign In for Pricing
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC942547-500 1x 500 µL
NKX2.8 (NKX28/2547), CF594 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNUB0142-100 1x 100 µL
Beta-2 Microglobulin (B2M) (BBM.1), 0.2mg/mL
Sign In for Pricing
View Details 
BNC042091-500 1x 500 µL
P53 Tumor Suppressor Protein (rTP53/1739), CF405S conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
PB9031-HRP 100 µg/Vial
Anti-TARC/CCL17 Antibody Picoband®, HRP Conjugate
Sign In for Pricing
View Details 
BNC942142-100 1x 100 µL
Albumin (Transport Protein) (ALB/2142), CF594 conjugate, 0.1mg/mL
Sign In for Pricing
View Details