Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Vaccinia virus Cell surface-binding protein OPG105 (D8L), partial

This Recombinant Vaccinia virus Cell surface-binding protein OPG105 (D8L), partial spans the amino acid sequence from region 1-261aa. Purity: Greater than 95% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Carbonic anhydrase homolog

UniProt

L7QJR5

Expression Region

1-261aa

Tag

C-terminal 6xHis-tagged

Source

E.coli

Origin

Vaccinia virus

Field of Research

Infectious Disease & Virology

Endotoxin

Not test

Purity

Greater than 95% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

36.1 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MPQQLSPINIETKKAISNARLKPLDIHYNESKPTTIQNTGKLVRINFKGGYISGGFLPNEYVLSSLRIYWGKEDDYGSNHLIDVYKYSGEINLVHWNKKKYSSYEEAKKHDDGLIIISIFLQVSDHKNVYFQKIVNQLDSIRSANTSAPFDSVFYLDNLLPSTLDYFTYLGTTINHSADAAWIIFPTPINIHSDQLSKFRTLLSSSNHDGKPHYITENYRNPYKLNDDTQVYYSGEIIRAATTSPARDNYFMRWLSDLRET

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

4E-BP1 (Ab-70) Antibody
8B8283-AAT 50 µg

4E-BP1 (Ab-70) Antibody

Sign In for Pricing
View Details
Elab Fluor® 647 Anti-Human CD41 Antibody[10E5-F0061]
AN00332M-01 20 Tests

Elab Fluor® 647 Anti-Human CD41 Antibody[10E5-F0061]

Sign In for Pricing
View Details
Elab Fluor® 647 Anti-Human CD41 Antibody[10E5-F0061]
AN00332M-02 100 Tests

Elab Fluor® 647 Anti-Human CD41 Antibody[10E5-F0061]

Sign In for Pricing
View Details
Elab Fluor® 647 Anti-Human CD41 Antibody[10E5-F0061]
AN00332M-03 2x 100 Tests

Elab Fluor® 647 Anti-Human CD41 Antibody[10E5-F0061]

Sign In for Pricing
View Details
b-Cyfluthrin
TRC-C989510-5G 5 g

b-Cyfluthrin

Sign In for Pricing
View Details
Recombinant Human NCF2/P67phox Protein
PKSH030527 100 µg

Recombinant Human NCF2/P67phox Protein

Sign In for Pricing
View Details