Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Lymphocyte antigen 6 complex locus protein G6c (LY6G6C)

This Recombinant Human Lymphocyte antigen 6 complex locus protein G6c (LY6G6C) spans the amino acid sequence from region 19-99aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

UniProt

O95867

Expression Region

19-99aa

Tag

N-terminal 6xHis-sumostar-tagged

Source

Yeast

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

22.3 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

DIRCHSCYKVPVLGCVDRQSCRLEPGQQCLTTHAYLGKMWVFSNLRCGTPEEPCQEAFNQTNRKLGLTYNTTCCNKDNCNS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Ebola Virus (Ebolavirus, EHF, Ebola Virus Disease, EV, EVD, EBOV, Ebola, Ebola Hemorrhagic Fever, Ebola Virus (Zaire)) (MaxLight 750)
MBS6265529-01 0.1 mL

Ebola Virus (Ebolavirus, EHF, Ebola Virus Disease, EV, EVD, EBOV, Ebola, Ebola Hemorrhagic Fever, Ebola Virus (Zaire)) (MaxLight 750)

Sign In for Pricing
View Details
Ebola Virus (Ebolavirus, EHF, Ebola Virus Disease, EV, EVD, EBOV, Ebola, Ebola Hemorrhagic Fever, Ebola Virus (Zaire)) (MaxLight 750)
MBS6265529-02 5x 0.1 mL

Ebola Virus (Ebolavirus, EHF, Ebola Virus Disease, EV, EVD, EBOV, Ebola, Ebola Hemorrhagic Fever, Ebola Virus (Zaire)) (MaxLight 750)

Sign In for Pricing
View Details
Rabbit Monoclonal CD31/PECAM-1 Antibody (C31/8593R) [Janelia Fluor 646]
NBP3-24155JF646 0.1 mL

Rabbit Monoclonal CD31/PECAM-1 Antibody (C31/8593R) [Janelia Fluor 646]

Sign In for Pricing
View Details
Recombinant Mouse Complement C4-B (C4b), partial
MBS9019843-01 0.02 mg (Yeast)

Recombinant Mouse Complement C4-B (C4b), partial

Sign In for Pricing
View Details
Recombinant Mouse Complement C4-B (C4b), partial
MBS9019843-02 0.1 mg (Yeast)

Recombinant Mouse Complement C4-B (C4b), partial

Sign In for Pricing
View Details
Recombinant Mouse Complement C4-B (C4b), partial
MBS9019843-03 1 mg (Yeast)

Recombinant Mouse Complement C4-B (C4b), partial

Sign In for Pricing
View Details