Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Pentadiplandra brazzeana Defensin-like protein

This Recombinant Pentadiplandra brazzeana Defensin-like protein spans the amino acid sequence from region 1-54aa. Purity: Greater than 95% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Brazzein

UniProt

P56552

Expression Region

1-54aa

Tag

C-terminal 6xHis-tagged

Source

Yeast

Origin

Pentadiplandra brazzeana

Endotoxin

Not test

Purity

Greater than 95% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

8.0 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

QDKCKKVYENYPVSKCQLANQCNYDCKLDKHARSGECFYDEKRNLQCICDYCEY

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

AKAP7 Rabbit Polyclonal Antibody
orb576074 100 µL

AKAP7 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
5- (4-Ethylphenyl) -7- (trifluoromethyl) pyrazolo[1,5-a]pyrimidine-2-carboxylic acid
434471-01 25 mg

5- (4-Ethylphenyl) -7- (trifluoromethyl) pyrazolo[1,5-a]pyrimidine-2-carboxylic acid

Sign In for Pricing
View Details
5- (4-Ethylphenyl) -7- (trifluoromethyl) pyrazolo[1,5-a]pyrimidine-2-carboxylic acid
434471-02 50 mg

5- (4-Ethylphenyl) -7- (trifluoromethyl) pyrazolo[1,5-a]pyrimidine-2-carboxylic acid

Sign In for Pricing
View Details
PON1 (NM_000446) Human Recombinant Protein
PH37298M5 20 µg

PON1 (NM_000446) Human Recombinant Protein

Sign In for Pricing
View Details
CAT Recombinant Protein
OPCD01922-200UG 200 µg

CAT Recombinant Protein

Sign In for Pricing
View Details
Anti-Kallikrein 5  (3H3)
YF-MA18005 100 ug

Anti-Kallikrein 5 (3H3)

Sign In for Pricing
View Details