Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Candida albicans Hyphally-regulated protein (HYR1), partial

This Recombinant Candida albicans Hyphally-regulated protein (HYR1), partial spans the amino acid sequence from region 103-321aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

UniProt

P46591

Expression Region

103-321aa

Tag

N-terminal 6xHis-sumostar-tagged

Source

Yeast

Origin

Candida albicans (Yeast)

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

37.1 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

SKSSTSFSNFDIGGSSFTNNGEIYLDSSGLVKSTAYLYAREWTNNGLIVAYQNQKAAGNIAFGTAYQTITNNGQICLRHQDFVPATKIKGTGCVTADEDTWIKLGNTILSVEPTHNFYLKDSKSSLIVHAVSSNQTFTVHGFGNGNKLGLTLPLTGNRDHFRFEYYPDTGILQLRADALPQYFKIGKGYDSKLFRIVNSRGLKNAVTYDGPVPNNEIPA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human LAMP2 Pre-designed siRNA Set A
SI008538A 1 Each

Human LAMP2 Pre-designed siRNA Set A

Sign In for Pricing
View Details
Mouse Metallothionein (MT) ELISA Kit
MBS269911-01 48 Well

Mouse Metallothionein (MT) ELISA Kit

Sign In for Pricing
View Details
Mouse Metallothionein (MT) ELISA Kit
MBS269911-02 96 Well

Mouse Metallothionein (MT) ELISA Kit

Sign In for Pricing
View Details
Mouse Metallothionein (MT) ELISA Kit
MBS269911-03 5x 96 Well

Mouse Metallothionein (MT) ELISA Kit

Sign In for Pricing
View Details
Mouse Metallothionein (MT) ELISA Kit
MBS269911-04 10x 96 Well

Mouse Metallothionein (MT) ELISA Kit

Sign In for Pricing
View Details
SOD2 Rabbit Polyclonal Antibody (Fluoro647)
orb3077381 100 µg

SOD2 Rabbit Polyclonal Antibody (Fluoro647)

Sign In for Pricing
View Details