Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse VIP peptides (Vip)

This Recombinant Mouse VIP peptides (Vip) spans the amino acid sequence from region 80-155aa. Purity: Greater than 95% as determined by SDS-PAGE.

Product Specifications

UniProt

P32648

Expression Region

80-155aa

Tag

N-terminal 6xHis-sumostar-tagged

Source

Yeast

Origin

Mus musculus (Mouse)

Field of Research

Neuroscience

Endotoxin

Not test

Purity

Greater than 95% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

21.8 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

RHADGVFTSDYSRLLGQISAKKYLESLIGKRISSSISEDPVPIKRHSDAVFTDNYTRLRKQMAVKKYLNSILNGKR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

COX IV Recombinant Rabbit monoclonal Antibody
HA750317 100 µL

COX IV Recombinant Rabbit monoclonal Antibody

Sign In for Pricing
View Details
Aspterric Acid
SIH-575-1MG 1 mg

Aspterric Acid

Sign In for Pricing
View Details
Monkey GDF15 Antibody Pair Set
E-KAB-0669 50 µL & 100 µg

Monkey GDF15 Antibody Pair Set

Sign In for Pricing
View Details
Human IFT43 activation kit by CRISPRa
GA114366 1 Kit

Human IFT43 activation kit by CRISPRa

Sign In for Pricing
View Details
TAF2 (NM_003184) Human Over-expression Lysate
LY418826 100 µg

TAF2 (NM_003184) Human Over-expression Lysate

Sign In for Pricing
View Details
Human MRPS2 activation kit by CRISPRa
GA109579 1 Kit

Human MRPS2 activation kit by CRISPRa

Sign In for Pricing
View Details