Recombinant Human Isoaspartyl peptidase/L-asparaginase (ASRGL1), partial
This Recombinant Human Isoaspartyl peptidase/L-asparaginase (ASRGL1), partial spans the amino acid sequence from region 168-308aa. Purity: Greater than 85% as determined by SDS-PAGE.
Product Specifications
Product Name Alternative
Asparaginase-like protein 1; Beta-aspartyl-peptidase; Isoaspartyl dipeptidase; L-asparagine amidohydrolase
UniProt
Q7L266
Expression Region
168-308aa
Tag
N-terminal 10xHis-tagged and C-terminal Myc-tagged
Source
E.coli
Origin
Homo sapiens (Human)
Field of Research
Metabolism Research
Endotoxin
Not test
Purity
Greater than 85% as determined by SDS-PAGE.
Form
Liquid or Lyophilized powder
Molecular Weight
19.6 kDa
Storage Conditions
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes
For research use only.
Applications Notes
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Preservative
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
AA Sequence
TVGAVALDCKGNVAYATSTGGIVNKMVGRVGDSPCLGAGGYADNDIGAVSTTGHGESILKVNLARLTLFHIEQGKTVEEAADLSLGYMKSRVKGLGGLIVVSKTGDWVAKWTSTSMPWAAAKDGKLHFGIDPDDTTITDLP
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC040352-100 1x 100 µL
CD31 / PECAM-1 (158-2B3), CF405S conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC940031-100 1x 100 µL
Mucin 5AC (MUC5AC) (45M1), CF594 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC140017-500 1x 500 µL
Ep-CAM / CD326 (VU-1D9), CF514 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC740723-100 1x 100 µL
P53 (BP53-12 + DO-7), CF740 conjugate, 0.1mg/mL
Sign In for Pricing
View Details