Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse High affinity copper uptake protein 1 (Slc31a1), partial

This Recombinant Mouse High affinity copper uptake protein 1 (Slc31a1), partial spans the amino acid sequence from region 1-74aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Copper transporter 1; Solute carrier family 31 member 1

UniProt

Q8K211

Expression Region

1-74aa

Tag

C-terminal 6xHis-tagged

Source

E.coli

Origin

Mus musculus (Mouse)

Field of Research

Neuroscience

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

15.3 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MNHMGMNHMEMHHHMGMNHTDDNITMPPHHHPTTSASHSHGGGDSMMMMPMTFYFDFKNVNLLFSGLVINTPGE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Glufosinate-d3 Hydrochloride
TRC-G596952-1MG 1 mg

Glufosinate-d3 Hydrochloride

Sign In for Pricing
View Details
PSAP (NM_001042466) Human Over-expression Lysate
LC420920 20 µg

PSAP (NM_001042466) Human Over-expression Lysate

Sign In for Pricing
View Details
NKX3.1 (Metastatic Prostate Adenocarcinoma Marker) (NKX3.1/2576), CF647 conjugate, 0.1mg/mL
BNC472576-100 1x 100 µL

NKX3.1 (Metastatic Prostate Adenocarcinoma Marker) (NKX3.1/2576), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Oryctalure
TRC-O675508-250MG 250 mg

Oryctalure

Sign In for Pricing
View Details
TTLL9 (NM_001008409) Human Over-expression Lysate
LY423431 100 µg

TTLL9 (NM_001008409) Human Over-expression Lysate

Sign In for Pricing
View Details
Hcn2 Mouse Monoclonal Antibody [Clone ID: N71/37]
75-111 100 µL

Hcn2 Mouse Monoclonal Antibody [Clone ID: N71/37]

Sign In for Pricing
View Details