Recombinant Human Splicing factor, proline- and glutamine-rich (SFPQ), partial
This Recombinant Human Splicing factor, proline- and glutamine-rich (SFPQ), partial spans the amino acid sequence from region 499-598aa. Purity: Greater than 95% as determined by SDS-PAGE.
Product Specifications
Product Name Alternative
100 kDa DNA-pairing protein; DNA-binding p52/p100 complex, 100 kDa subunit; Polypyrimidine tract-binding protein-associated-splicing factor
UniProt
P23246
Expression Region
499-598aa
Tag
C-terminal Myc-tagged
Source
E.coli
Origin
Homo sapiens (Human)
Field of Research
Epigenetics & Chromatin; Pharmacology & Drug Discovery
Endotoxin
Not test
Purity
Greater than 95% as determined by SDS-PAGE.
Form
Liquid or Lyophilized powder
Molecular Weight
20.4 kDa
Storage Conditions
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes
For research use only.
Applications Notes
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Preservative
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
AA Sequence
EMEKQQREQVEKNMKDAKDKLESEMEDAYHEHQANLLRQDLMRRQEELRRMEELHNQEMQKRKEMQLRQEEERRRREEEMMIRQREMEEQMRRQREESYS
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
orb895119 100 µL
Phospho-CTNNBIP1 (Thr43+Ser50) Rabbit Polyclonal Antibody (Cy5)
Sign In for Pricing
View Details E45H50691M2-100 100 µg
TACI Protein, Human, Recombinant (ECD, His Tag)
Sign In for Pricing
View Details