Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Fos-related antigen 1 (FOSL1)

This Recombinant Human Fos-related antigen 1 (FOSL1) spans the amino acid sequence from region 1-271aa. Purity: Greater than 95% as determined by SDS-PAGE.

Product Specifications

UniProt

P15407

Expression Region

1-271aa

Tag

C-terminal 6xHis-tagged

Source

Yeast

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation; Cell Biology

Endotoxin

Not test

Purity

Greater than 95% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

30.9 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MFRDFGEPGPSSGNGGGYGGPAQPPAAAQAAQQKFHLVPSINTMSGSQELQWMVQPHFLGPSSYPRPLTYPQYSPPQPRPGVIRALGPPPGVRRRPCEQISPEEEERRRVRRERNKLAAAKCRNRRKELTDFLQAETDKLEDEKSGLQREIEELQKQKERLELVLEAHRPICKIPEGAKEGDTGSTSGTSSPPAPCRPVPCISLSPGPVLEPEALHTPTLMTTPSLTPFTPSLVFTYPSTPEPCASAHRKSSSSSGDPSSDPLGSPTLLAL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

mmu-miR-378b miRNA Inhibitor
MBS8296420-01 10 nmol

mmu-miR-378b miRNA Inhibitor

Sign In for Pricing
View Details
mmu-miR-378b miRNA Inhibitor
MBS8296420-02 20 nmol

mmu-miR-378b miRNA Inhibitor

Sign In for Pricing
View Details
mmu-miR-378b miRNA Inhibitor
MBS8296420-03 5x 20 nmol

mmu-miR-378b miRNA Inhibitor

Sign In for Pricing
View Details
3-Pentanol 98%
P04190-01 25 g

3-Pentanol 98%

Sign In for Pricing
View Details
3-Pentanol 98%
P04190-02 100 g

3-Pentanol 98%

Sign In for Pricing
View Details
3-Pentanol 98%
P04190-03 500 g

3-Pentanol 98%

Sign In for Pricing
View Details