Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Cat Prolactin (PRL)

This Recombinant Cat Prolactin (PRL) spans the amino acid sequence from region 31-229aa. Purity: Greater than 95% as determined by SDS-PAGE.

Product Specifications

UniProt

P46403

Expression Region

31-229aa

Tag

C-terminal 6xHis-tagged

Source

Yeast

Origin

Felis catus (Cat)

Field of Research

Metabolism Research

Endotoxin

Not test

Purity

Greater than 95% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

24.2 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

LPICPSGAVNCQVSLRDLFDRAVILSHYIHNLSSEMFNEFDKRYAQGRGFITKAINSCHTSSLPTPEDKEQAQQIHHEDLLNVILRVLRSWNDPLYHLVTEVRGLHEAPDAILSRAIEIEEQNRRLLEGMEKIVHQVHPGVRENEVYSVWSGLPSLQMADEDSRLFAFYNLLHCLRRDSHKIDSYLKLLKCRIVYDSNC

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Aluminium potassium sulfate anhydrous p.A.
LC-10423.1 2.5 Kg

Aluminium potassium sulfate anhydrous p.A.

Sign In for Pricing
View Details
Recombinant Human CAVIN1
MBS7612856-01 0.05 mg

Recombinant Human CAVIN1

Sign In for Pricing
View Details
Recombinant Human CAVIN1
MBS7612856-02 0.2 mg

Recombinant Human CAVIN1

Sign In for Pricing
View Details
Recombinant Human CAVIN1
MBS7612856-03 1 mg

Recombinant Human CAVIN1

Sign In for Pricing
View Details
Recombinant Human CAVIN1
MBS7612856-04 5x 1 mg

Recombinant Human CAVIN1

Sign In for Pricing
View Details
Olfr1501 Mouse qPCR Primer Pair (NM_146633)
MP209683 200 Reactions

Olfr1501 Mouse qPCR Primer Pair (NM_146633)

Sign In for Pricing
View Details