Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Macaca fascicularis Platelet-derived growth factor receptor alpha (PDGFRA), partial

This Recombinant Macaca fascicularis Platelet-derived growth factor receptor alpha (PDGFRA), partial spans the amino acid sequence from region 24-524aa. Purity: Greater than 95% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Alpha platelet-derived growth factor receptor; Alpha-type platelet-derived growth factor receptor

UniProt

Q0PW86

Expression Region

24-524aa

Tag

C-terminal 10xHis-tagged

Source

Mammalian cell

Origin

Macaca fascicularis (Crab-eating macaque) (Cynomolgus monkey)

Field of Research

Stem Cell & Developmental Biology

Endotoxin

Not test

Purity

Greater than 95% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

57.6 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

QLSLPSILPNENEKVVQLNSSFSLRCFGESEVSWQYPMSEEENSDVEIRNEENNSGLFVTVLEVSSASAAHTGLYTCYYNHTQTEENELEGRHIYIYVPDPDVAFVPLGMTDYLVIVEDDDSAIIPCRTTDPETPVTLHNSEGVVPASYNSRQGFNGTFTVGPYICEATVKGKKFQTIPFNVYALKATSELDLEMEALKTVYKSGETIVVTCAVFNNEVVDLQWTYPGEVKGKGITMLEEIKVPSIKLVYTLTVPEATVKDSGDYECAARQATREVKEMKRVTISVHEKGFIEIKPTFSQLEAVNLHEVKHFVVEVQAYPPPRISWLKNNLTLIENLTEITTDVEKIQEIRYRSKLKLIRAKEEDSGHYTIVAQNEDDVKSYTFELLTQVPSSILDLVDDHHGSTGGQTVRCTAEGMPLPDIEWMICKDIKKCNNETSWTILANNVSNIITEIHPRDRSTVEGLVTFAKVEETIAVRCLAKNLLGAENRELKLVAPTLRSE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Hsa-miR-524-3p miRNA Antagomir
orb1916029-01 10 nmol

Hsa-miR-524-3p miRNA Antagomir

Sign In for Pricing
View Details
Hsa-miR-524-3p miRNA Antagomir
orb1916029-02 20 nmol

Hsa-miR-524-3p miRNA Antagomir

Sign In for Pricing
View Details
Syphilis Cassette
ABT-STD-B60 25 Tests

Syphilis Cassette

Sign In for Pricing
View Details
ZSWIM3 Antibody
DF15986-01 100 µL

ZSWIM3 Antibody

Sign In for Pricing
View Details
ZSWIM3 Antibody
DF15986-02 200 µL

ZSWIM3 Antibody

Sign In for Pricing
View Details
Universal indicator solution (pH 0-10 & 9-14) in twin packs)
3125655 1 Each

Universal indicator solution (pH 0-10 & 9-14) in twin packs)

Sign In for Pricing
View Details