Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human TATA-binding protein-associated factor 2N (TAF15), partial

This Recombinant Human TATA-binding protein-associated factor 2N (TAF15), partial spans the amino acid sequence from region 110-592aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

68 kDa TATA-binding protein-associated factor; RNA-binding protein 56

UniProt

Q92804

Expression Region

110-592aa

Tag

C-terminal 6xHis-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Epigenetics & Chromatin

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

57.1 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

YGQQDSYDQQSGYDQHQGSYDEQSNYDQQHDSYSQNQQSYHSQRENYSHHTQDDRRDVSRYGEDNRGYGGSQGGGRGRGGYDKDGRGPMTGSSGGDRGGFKNFGGHRDYGPRTDADSESDNSDNNTIFVQGLGEGVSTDQVGEFFKQIGIIKTNKKTGKPMINLYTDKDTGKPKGEATVSFDDPPSAKAAIDWFDGKEFHGNIIKVSFATRRPEFMRGGGSGGGRRGRGGYRGRGGFQGRGGDPKSGDWVCPNPSCGNMNFARRNSCNQCNEPRPEDSRPSGGDFRGRGYGGERGYRGRGGRGGDRGGYGGDRSGGGYGGDRSSGGGYSGDRSGGGYGGDRSGGGYGGDRGGGYGGDRGGGYGGDRGGGYGGDRGGYGGDRGGGYGGDRGGYGGDRGGYGGDRGGYGGDRGGYGGDRSRGGYGGDRGGGSGYGGDRSGGYGGDRSGGGYGGDRGGGYGGDRGGYGGKMGGRNDYRNDQRNRPY

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral human APOL2 shRNA (UAS) - Lentiviral human APOL2 shRNA (UAS) (100)
GTR15093606 1 Vial

Lentiviral human APOL2 shRNA (UAS) - Lentiviral human APOL2 shRNA (UAS) (100)

Sign In for Pricing
View Details
KLC4 siRNA Oligos set (Human)
25738171 3x 5 nmol

KLC4 siRNA Oligos set (Human)

Sign In for Pricing
View Details
HDAC6 Antibody
orb1178179 100 µg

HDAC6 Antibody

Sign In for Pricing
View Details
Eukaryotic Translation Initiation Factor 4 gamma , 2 Antibody
abx112380 100 µL

Eukaryotic Translation Initiation Factor 4 gamma , 2 Antibody

Sign In for Pricing
View Details
ARHGAP26 Antibody
MBS859153-01 0.1 mg

ARHGAP26 Antibody

Sign In for Pricing
View Details
ARHGAP26 Antibody
MBS859153-02 0.1 mL (AF405L)

ARHGAP26 Antibody

Sign In for Pricing
View Details