Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Interferon gamma receptor 1 (Ifngr1), partial

This Recombinant Mouse Interferon gamma receptor 1 (Ifngr1), partial spans the amino acid sequence from region 26-254aa. Purity: Greater than 95% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Interferon gamma receptor alpha-chain

UniProt

P15261

Expression Region

26-254aa

Tag

C-terminal hFc1-tagged

Source

Mammalian cell

Origin

Mus musculus (Mouse)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 95% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

54.9 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

ALTSTEDPEPPSVPVPTNVLIKSYNLNPVVCWEYQNMSQTPIFTVQVKVYSGSWTDSCTNISDHCCNIYEQIMYPDVSAWARVKAKVGQKESDYARSKEFLMCLKGKVGPPGLEIRRKKEEQLSVLVFHPEVVVNGESQGTMFGDGSTCYTFDYTVYVEHNRSGEILHTKHTVEKEECNETLCELNISVSTLDSRYCISVDGISSFWQVRTEKSKDVCIPPFHDDRKDS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Polystyrene A CHO
HA40045006.5G 5 g

Polystyrene A CHO

Sign In for Pricing
View Details
p-Azidoacetophenone
TRC-A821250-500MG 500 mg

p-Azidoacetophenone

Sign In for Pricing
View Details
APC Anti-Mouse CD8 Antibody[YTS-169]
AN00576E-01 50 Tests

APC Anti-Mouse CD8 Antibody[YTS-169]

Sign In for Pricing
View Details
APC Anti-Mouse CD8 Antibody[YTS-169]
AN00576E-02 100 Tests

APC Anti-Mouse CD8 Antibody[YTS-169]

Sign In for Pricing
View Details
APC Anti-Mouse CD8 Antibody[YTS-169]
AN00576E-03 2x 100 Tests

APC Anti-Mouse CD8 Antibody[YTS-169]

Sign In for Pricing
View Details
NKX2.8 (NKX28/2547), Biotin conjugate, 0.1mg/mL
BNCB2547-100 1x 100 µL

NKX2.8 (NKX28/2547), Biotin conjugate, 0.1mg/mL

Sign In for Pricing
View Details