Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human TATA-binding protein-associated factor 2N (TAF15), partial

This Recombinant Human TATA-binding protein-associated factor 2N (TAF15), partial spans the amino acid sequence from region 1-150aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

68 kDa TATA-binding protein-associated factor; RNA-binding protein 56

UniProt

Q92804

Expression Region

1-150aa

Tag

C-terminal 6xHis-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Epigenetics & Chromatin

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

23.5 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MSDSGSYGQSGGEQQSYSTYGNPGSQGYGQASQSYSGYGQTTDSSYGQNYSGYSSYGQSQSGYSQSYGGYENQKQSSYSQQPYNNQGQQQNMESSGSQGGRAPSYDQPDYGQQDSYDQQSGYDQHQGSYDEQSNYDQQHDSYSQNQQSYH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

AKT1 Human Gene Knockout Kit (CRISPR)
KN201850 1 Kit

AKT1 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Human Apc4 (ANAPC4) activation kit by CRISPRa
GA109330 1 Kit

Human Apc4 (ANAPC4) activation kit by CRISPRa

Sign In for Pricing
View Details
MCM2 Mouse Monoclonal Antibody [Clone ID: OTI1G10]
CF805521 100 µg

MCM2 Mouse Monoclonal Antibody [Clone ID: OTI1G10]

Sign In for Pricing
View Details
Tissue FFPE Sections, Thyroid gland
CS709308 5x 5 µm

Tissue FFPE Sections, Thyroid gland

Sign In for Pricing
View Details
Protogel Sample Prep Kit
EC-884 1 Kit

Protogel Sample Prep Kit

Sign In for Pricing
View Details
C16orf55 (SPATA33) Human Gene Knockout Kit (CRISPR)
KN417400 1 Kit

C16orf55 (SPATA33) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details