Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Mouse Thrombin-Thrombomodulin Complex ELISA Kit

Product Specifications

CAS Number

7732-18-5

Gene Name

[T-TM]

Reactivity

Mouse

Storage Conditions

Store all reagents at 2-8 °C

Short Name

[Thrombin-Thrombomodulin Complex]

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rnf138 sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 2)
K4669007 1.0 µg DNA

Rnf138 sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 2)

Sign In for Pricing
View Details
Hsa-miR-4490 antagomir
HY-RI01099A-01 5 nmol

Hsa-miR-4490 antagomir

Sign In for Pricing
View Details
Hsa-miR-4490 antagomir
HY-RI01099A-02 20 nmol

Hsa-miR-4490 antagomir

Sign In for Pricing
View Details
VSGLNPSLWSIFGLQFILLWLVSGSRHYLW
T76250-01 5 mg

VSGLNPSLWSIFGLQFILLWLVSGSRHYLW

Sign In for Pricing
View Details
VSGLNPSLWSIFGLQFILLWLVSGSRHYLW
T76250-02 50 mg

VSGLNPSLWSIFGLQFILLWLVSGSRHYLW

Sign In for Pricing
View Details
Human ARF5 Protein Lysate
MBS137435-01 0.02 mg

Human ARF5 Protein Lysate

Sign In for Pricing
View Details