Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TARC/CCL17, Mouse (70a.a)

TARC/CCL17 Protein, Mouse (70a.a) is the first CC chemokine identified to interact with T cells with high affinity and bind to the CCR4 receptor to mediate inflammation, cancer, and autoimmune related diseases. TARC/CCL17 Protein, Mouse is a recombinant mouse TARC/CCL17 (A34-P103) protein expressed by E. coli[1][2].

Product Specifications

Product Name Alternative

TARC/CCL17 Protein, Mouse (70a.a), Mouse, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/tarc-ccl17-protein-mouse.html

Purity

97.00

Smiles

ARATNVGRECCLDYFKGAIPIRKLVSWYKTSVECSRDAIVFLTVQGKLICADPKDKHVKKAIRLVKNPRP

Molecular Formula

20295 (Gene_ID) F6R5P4 (A34-P103) (Accession)

Molecular Weight

Approximately 9 kDa, based on SDS-PAGE under reducing conditions.

References & Citations

[1]Jo KM , et al. Thymus and activation-regulated chemokine (TARC) /CCL17 and IgE are associated with elderly asthmatics. Immun Ageing. 2018 May 5;15:13.|[2]Osabe M, et al. Allopurinol suppresses expression of the regulatory T-cell migration factors TARC/CCL17 and MDC/CCL22 in HaCaT keratinocytes via restriction of nuclear factor-κB activation.J Appl Toxicol. 2018 Feb;38 (2) :274-283.|[3]Julien Catherine, et al. What does elevated TARC/CCL17 expression tell us about eosinophilic disorders? Semin Immunopathol. 2021 Jun;43 (3) :439-458.|[4]Jan Korbecki, et al. CC Chemokines in a Tumor: A Review of Pro-Cancer and Anti-Cancer Properties of the Ligands of Receptors CCR1, CCR2, CCR3, and CCR4. Int J Mol Sci. 2020 Nov 9;21 (21) :8412.|[5]Christian Vestergaard, et al. Thymus- and activation-regulated chemokine (TARC/CCL17) induces a Th2-dominated inflammatory reaction on intradermal injection in mice. Exp Dermatol. 2004 Apr;13 (4) :265-71.|[6]Shuixiang Deng, et al. Recombinant CCL17 Enhances Hematoma Resolution and Activation of CCR4/ERK/Nrf2/CD163 Signaling Pathway After Intracerebral Hemorrhage in Mice. Neurotherapeutics. 2020 Oct;17 (4) :1940-1953.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Vinpocetine EP Impurity A
RM-V091901-01 10 mg

Vinpocetine EP Impurity A

Sign In for Pricing
View Details
Vinpocetine EP Impurity A
RM-V091901-02 25 mg

Vinpocetine EP Impurity A

Sign In for Pricing
View Details
Vinpocetine EP Impurity A
RM-V091901-03 50 mg

Vinpocetine EP Impurity A

Sign In for Pricing
View Details
Vinpocetine EP Impurity A
RM-V091901-04 100 mg

Vinpocetine EP Impurity A

Sign In for Pricing
View Details
Rat AP 3 complex subunit sigma 1 (AP3S1) ELISA kit
GTR10387158 96 Well

Rat AP 3 complex subunit sigma 1 (AP3S1) ELISA kit

Sign In for Pricing
View Details
Nkx2-1 ORF Vector (Mouse) (pORF)
31878014 1.0 µg DNA

Nkx2-1 ORF Vector (Mouse) (pORF)

Sign In for Pricing
View Details