Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Aflatoxin B1 aldehyde reductase member 2 (AKR7A2)

This Recombinant Human Aflatoxin B1 aldehyde reductase member 2 (AKR7A2) spans the amino acid sequence from region 1-359aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

AFB1 aldehyde reductase 1; Aldoketoreductase 7; Succinic semialdehyde reductase

UniProt

O43488

Expression Region

1-359aa

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Signal Transduction

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

47.0 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MLSAASRVVSRAAVHCALRSPPPEARALAMSRPPPPRVASVLGTMEMGRRMDAPASAAAVRAFLERGHTELDTAFMYSDGQSETILGGLGLGLGGGDCRVKIATKANPWDGKSLKPDSVRSQLETSLKRLQCPQVDLFYLHAPDHGTPVEETLHACQRLHQEGKFVELGLSNYASWEVAEICTLCKSNGWILPTVYQGMYNATTRQVETELFPCLRHFGLRFYAYNPLAGGLLTGKYKYEDKDGKQPVGRFFGNSWAETYRNRFWKEHHFEAIALVEKALQAAYGASAPSVTSAALRWMYHHSQLQGAHGDAVILGMSSLEQLEQNLAATEEGPLEPAVVDAFNQAWHLVAHECPNYFR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Plant Protein Tyrosine Phosphatase Receptor Type H (PTPRH) ELISA Kit
MBS9375071 Inquire

Plant Protein Tyrosine Phosphatase Receptor Type H (PTPRH) ELISA Kit

Sign In for Pricing
View Details
CARD10 Rabbit pAb, AE conjugated
orb2866482 100 µL

CARD10 Rabbit pAb, AE conjugated

Sign In for Pricing
View Details
Fam19a1 3'UTR GFP Stable Cell Line
TU156239 1.0 mL

Fam19a1 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details
DUTP5 Protein Vector (Human) (pPB-N-His)
PV074282 500 ng

DUTP5 Protein Vector (Human) (pPB-N-His)

Sign In for Pricing
View Details
Cyfra21-1 (CK19) Antibody-HRP
MBS850016-01 0.1 mg

Cyfra21-1 (CK19) Antibody-HRP

Sign In for Pricing
View Details
Cyfra21-1 (CK19) Antibody-HRP
MBS850016-02 0.1 mL (AF635)

Cyfra21-1 (CK19) Antibody-HRP

Sign In for Pricing
View Details