Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Aquaporin-4 (AQP4), partial, Biotinylated

This Recombinant Human Aquaporin-4 (AQP4), partial, Biotinylated spans the amino acid sequence from region 253-323aa. Purity: Greater than 95% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Mercurial-insensitive water channel; WCH4

UniProt

P55087

Expression Region

253-323aa

Tag

N-terminal 6xHis-SUMO3-Avi-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Kidney & Urological Research

Purity

Greater than 95% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

21.9 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

CPDVEFKRRFKEAFSKAAQQTKGSYMEVEDNRSQVETDDLILKPGVVHVIDVDRGEEKKGKDQSGEVLSSV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

NCRNA00085 Protein Lysate (Human) with C-Ha Tag
31583031 100 µg

NCRNA00085 Protein Lysate (Human) with C-Ha Tag

Sign In for Pricing
View Details
LOC105369261 mouse monoclonal antibody, clone 1D4, FITC
AM26433FC-N 50 Tests

LOC105369261 mouse monoclonal antibody, clone 1D4, FITC

Sign In for Pricing
View Details
Human Nucleoporin 62kDa (NUP62) ELISA Kit
RD-NUP62-Hu-96Tests 96 Tests

Human Nucleoporin 62kDa (NUP62) ELISA Kit

Sign In for Pricing
View Details
Zbed3 (NM_028106) Mouse Tagged Lenti ORF Clone
MR202738L3 10 µg

Zbed3 (NM_028106) Mouse Tagged Lenti ORF Clone

Sign In for Pricing
View Details
RPL36P13 sgRNA CRISPR Lentivector (Human) (Target 2)
K1985103 1.0 µg DNA

RPL36P13 sgRNA CRISPR Lentivector (Human) (Target 2)

Sign In for Pricing
View Details
CEBPB Antibody
orb1253168 0.1 mg

CEBPB Antibody

Sign In for Pricing
View Details