Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Bone morphogenetic protein 4 (Bmp4)

This Recombinant Mouse Bone morphogenetic protein 4 (Bmp4) spans the amino acid sequence from region 293-408aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Bone morphogenetic protein 2B

UniProt

P21275

Expression Region

293-408aa

Tag

N-terminal 6xHis-tagged

Source

E.coli

Origin

Mus musculus (Mouse)

Field of Research

Stem Cell & Developmental Biology; Musculoskeletal & Connective Tissue Research

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

20.1 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

SPKHHPQRSRKKNKNCRRHSLYVDFSDVGWNDWIVAPPGYQAFYCHGDCPFPLADHLNSTNHAIVQTLVNSVNSSIPKACCVPTELSAISMLYLDEYDKVVLKNYQEMVVEGCGCR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral human RBM27 sgRNA gene knockout kit - Lentiviral human RBM27 sgRNA gene knockout kit (plasmid)
GTR15354298 1 Vial

Lentiviral human RBM27 sgRNA gene knockout kit - Lentiviral human RBM27 sgRNA gene knockout kit (plasmid)

Sign In for Pricing
View Details
Human DYRK3 Knockout A549 cell line
GTR15414012 1 Vial

Human DYRK3 Knockout A549 cell line

Sign In for Pricing
View Details
RGD1311892 Protein Vector (Rat) (pPB-N-His)
PV300039 500 ng

RGD1311892 Protein Vector (Rat) (pPB-N-His)

Sign In for Pricing
View Details
SAE1/UBA2 Complex, Active
MBS517742-01 0.02 mg

SAE1/UBA2 Complex, Active

Sign In for Pricing
View Details
SAE1/UBA2 Complex, Active
MBS517742-02 0.1 mg

SAE1/UBA2 Complex, Active

Sign In for Pricing
View Details
SAE1/UBA2 Complex, Active
MBS517742-03 1 mg

SAE1/UBA2 Complex, Active

Sign In for Pricing
View Details