Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Bone morphogenetic protein 4 (Bmp4)

This Recombinant Mouse Bone morphogenetic protein 4 (Bmp4) spans the amino acid sequence from region 293-408aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Bone morphogenetic protein 2B

UniProt

P21275

Expression Region

293-408aa

Tag

N-terminal 6xHis-tagged

Source

E.coli

Origin

Mus musculus (Mouse)

Field of Research

Stem Cell & Developmental Biology; Musculoskeletal & Connective Tissue Research

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

20.1 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

SPKHHPQRSRKKNKNCRRHSLYVDFSDVGWNDWIVAPPGYQAFYCHGDCPFPLADHLNSTNHAIVQTLVNSVNSSIPKACCVPTELSAISMLYLDEYDKVVLKNYQEMVVEGCGCR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

XPNPEP1 siRNA (Mouse)
CRN1355-01 15 nmol

XPNPEP1 siRNA (Mouse)

Sign In for Pricing
View Details
XPNPEP1 siRNA (Mouse)
CRN1355-02 30 nmol

XPNPEP1 siRNA (Mouse)

Sign In for Pricing
View Details
Human IFI27 (NM_001288958) AAV Particle
RC235764A1V 250 µL

Human IFI27 (NM_001288958) AAV Particle

Sign In for Pricing
View Details
Kinesis union LP PEEK 1/4-28 1/16 0.02 Thru-hole
CHR4383 1 Each

Kinesis union LP PEEK 1/4-28 1/16 0.02 Thru-hole

Sign In for Pricing
View Details
Oxalate Standard for Ion Chromatography
AS-C2O49-2Y 125 mL

Oxalate Standard for Ion Chromatography

Sign In for Pricing
View Details
Ano1 Rat shRNA Lentiviral Particle (Locus ID 309135)
TL706118V 500 µL Each

Ano1 Rat shRNA Lentiviral Particle (Locus ID 309135)

Sign In for Pricing
View Details