Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Bone morphogenetic protein 6 (Bmp6)

This Recombinant Mouse Bone morphogenetic protein 6 (Bmp6) spans the amino acid sequence from region 372-510aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

VG-1-related protein

UniProt

P20722

Expression Region

372-510aa

Tag

N-terminal 6xHis-tagged and C-terminal 6xHis-tagged

Source

E.coli

Origin

Mus musculus (Mouse)

Field of Research

Stem Cell & Developmental Biology; Musculoskeletal & Connective Tissue Research

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

25.6 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

SASSRRRQQSRNRSTQSQDVSRGSGSSDYNGSELKTACKKHELYVSFQDLGWQDWIIAPKGYAANYCDGECSFPLNAHMNATNHAIVQTLVHLMNPEYVPKPCCAPTKLNAISVLYFDDNSNVILKKYRNMVVRACGCH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

L-Cysteine-d3,15N
HY-Y0337S7 1 mg

L-Cysteine-d3,15N

Sign In for Pricing
View Details
NUP62 (Nuclear Pore Glycoprotein p62, 62kD Nucleoporin, Nucleoporin Nup62) (MaxLight 550)
130653-ML550 100 µL

NUP62 (Nuclear Pore Glycoprotein p62, 62kD Nucleoporin, Nucleoporin Nup62) (MaxLight 550)

Sign In for Pricing
View Details
Anti-Beclin 1/BECN1 Antibody Picoband®, FITC Conjugate
PA1847-FITC 100 µg/Vial

Anti-Beclin 1/BECN1 Antibody Picoband®, FITC Conjugate

Sign In for Pricing
View Details
Toxoplasma gondii Grade III Antigen (Toxo III antigen) discontinued
171780 1 mg

Toxoplasma gondii Grade III Antigen (Toxo III antigen) discontinued

Sign In for Pricing
View Details
SuO-Val-Cit-PAB-MMAE
T18736-01 100 mg

SuO-Val-Cit-PAB-MMAE

Sign In for Pricing
View Details
SuO-Val-Cit-PAB-MMAE
T18736-02 500 mg

SuO-Val-Cit-PAB-MMAE

Sign In for Pricing
View Details